PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10012451m
Common NameCARUB_v10012451mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 200aa    MW: 22799.7 Da    PI: 8.4834
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10012451mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ l+d+++ +G g+W++ ++  g+ R++k+c++rw +yl
  Carubv10012451m 14 KGAWTKEEDQCLIDYIRNHGEGSWRSLPNSAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding52.61.1e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T  Ed++++++++++G++ W++Ia +++ gRt++++k++w+++
  Carubv10012451m  67 RGNFTDGEDQIIIKLHNLFGNK-WSLIAGKLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.5E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.01961IPR017930Myb domain
SMARTSM007174.3E-121363IPR001005SANT/Myb domain
SuperFamilySSF466892.52E-2913108IPR009057Homeodomain-like
PfamPF002497.5E-161461IPR001005SANT/Myb domain
CDDcd001671.13E-91661No hitNo description
PROSITE profilePS5129426.88662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-2765116IPR009057Homeodomain-like
SMARTSM007177.4E-1666114IPR001005SANT/Myb domain
PfamPF002498.5E-1567111IPR001005SANT/Myb domain
CDDcd001673.17E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009631Biological Processcold acclimation
GO:0009651Biological Processresponse to salt stress
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQCLIDYIR NHGEGSWRSL PNSAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TDGEDQIIIK LHNLFGNKWS LIAGKLPGRT DNEIKNYWNT HIKRKLLSRG  120
IDPKTHRSIV EPNTTPFNSL ARDVKSTCPD HVKPKTYTLS ENCATTSGTT TDEDLWLSVD  180
RDFSYDFGDK ELNLELTLGS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006303828.11e-148hypothetical protein CARUB_v10012451mg, partial
SwissprotQ388513e-99MYB6_ARATH; Transcription repressor MYB6
TrEMBLR0GLS91e-148R0GLS9_9BRAS; Uncharacterized protein (Fragment)
STRINGAT1G35515.11e-115(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G35515.11e-119high response to osmotic stress 10